Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486848

Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CKN1, CSA, UVSS2, 2410022P04Rik, 2810431L23Rik, 4631412O06Rik, B130065P18Rik, Ckn1, Csa, zgc:103550
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN486848
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8
Sequence QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFE DAWSSSDEEG
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 85%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against ERCC8. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ERCC8
Background ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript
Molecular Weight 44kDa
Gene ID 1161
NCBI Accession NP_000073, NM_000082
UniProt Q13216
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ERCC8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Groisman, Polanowska, Kuraoka et al.: "The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage." in: Cell, Vol. 113, Issue 3, pp. 357-67, 2003 (PubMed).

Alternatives for antigen "Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8)", type "Antibodies"
Hosts (36), (7)
Reactivities (42), (20), (14), (3), (3), (1), (1)
Applications (31), (10), (8), (8), (7), (6), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (3), (3), (3), (2), (1), (1)
Beacon