Did you know that you can buy products from over 140 different suppliers from us?

Breast Cancer 1 (BRCA1) (Middle Region) antibody

Details for Product No. ABIN487054
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRCA1
Epitope
Middle Region
(42), (36), (24), (20), (17), (17), (15), (15), (14), (14), (12), (9), (7), (7), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(363), (42), (25), (13), (2), (1), (1), (1)
Host
Rabbit
(322), (60), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(17), (15), (12), (9), (9), (9), (9), (9), (9), (9), (9), (3), (3), (3), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(215), (107), (90), (86), (73), (72), (54), (7), (5), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487054
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human BRCA1
Sequence DDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSP SPFTHTHLAQ
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against BRCA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name BRCA1
Background The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability and acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as BASC for BRCA1-associated genome surveillance complex. This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complex. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40 % of inherited breast cancers and more than 80 % of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants have been described for this gene but only some have had their full-length natures identified.
Molecular Weight 208 kDa
Gene ID 672
NCBI Accession NM_007294, NP_009225
UniProt P38398
Research Area Cancer, Transcription Factors, Proteolysis / Ubiquitin, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1863 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Breast Cancer 1 (BRCA1) (Middle Region) antibody WB Suggested Anti-BRCA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine
Product cited in: Evans, Shenton, Woodward et al.: "Penetrance estimates for BRCA1 and BRCA2 based on genetic testing in a Clinical Cancer Genetics service setting: risks of breast/ovarian cancer quoted should reflect the cancer burden in the family." in: BMC cancer, Vol. 8, pp. 155, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487054
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top