Nasal Embryonic LHRH Factor (NELF) (N-Term) antibody

Details for Product No. ABIN502261
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HH9, NELF, Jacob, Nelf, Jac, nelf, nelfb, nsmf, si:ch73-239f21.1, rp11-48c7.1
Epitope
N-Term
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
(23), (20), (20), (13), (12)
Host
Rabbit
(24), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (10), (9), (4), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502261
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NELF
Sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENR NGADHLLADA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against NELF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NELF
Background NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
Molecular Weight 60 kDa
Gene ID 26012
NCBI Accession NM_015537, NP_056352
UniProt Q6X4W1-2
Research Area Neurology, Neurogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 528 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Hosts (24), (1)
Reactivities (23), (20), (20), (13), (12)
Applications (16), (10), (9), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top