Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502261

Nasal Embryonic LHRH Factor (NELF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HH9, NELF, Jacob, Nelf, Jac, nelf, nelfb, nsmf, si:ch73-239f21.1, rp11-48c7.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502261
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NELF antibody: synthetic peptide directed towards the N terminal of human NELF
Sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENR NGADHLLADA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against NELF. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NELF
Background NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
Molecular Weight 60kDa
Gene ID 26012
NCBI Accession NP_056352, NM_015537
UniProt Q6X4W1-2
Research Area Neurology, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NELF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Nasal Embryonic LHRH Factor (NELF)", type "Antibodies"
Hosts (31), (2)
Reactivities (31), (20), (20), (13), (12)
Applications (24), (11), (10), (5), (4), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon