NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) antibody

Catalog No. ABIN629701

Product Details

Target:

NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Binding Specificity: Middle Region

Reactivity: Dog, Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: NELF antibody was raised against the middle region of NELF

Purification: Purified

Immunogen: NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target:

NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Alternative Name: NELF (NSMF Antibody Abstract)

Background: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Synaptic Membrane