NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) antibody
-
- Target See all NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) Antibodies
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NELF antibody was raised against the middle region of NELF
- Purification
- Purified
- Immunogen
- NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG
- Top Product
- Discover our top product NSMF Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
- Alternative Name
- NELF (NSMF Products)
- Background
- NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-