Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4) (N-Term) antibody

Details for Product No. ABIN504511
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PC4, SPC5, AI647044, L21221, NEC 3, NEC3, PCSK4, pc4, spc5, MGC146505
Epitope
N-Term
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(21), (4), (4)
Host
Rabbit
(21), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN504511
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PCSK4
Sequence VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLR HRGVVQQSLT
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Guinea pig : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against PCSK4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PCSK4
Background PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR, MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).
Molecular Weight 83 kDa
Gene ID 54760
NCBI Accession NM_017573, NP_060043
UniProt Q6UW60
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 755 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4) (N-Term) antibody WB Suggested Anti-PCSK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate
Background publications Qiu, Basak, Mbikay et al.: "Role of pro-IGF-II processing by proprotein convertase 4 in human placental development." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 102, Issue 31, pp. 11047-52, 2005 (PubMed).

Hosts (21), (2)
Reactivities (21), (4), (4)
Applications (14), (10), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top