Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Nop10 antibody (NOP10 Ribonucleoprotein Homolog (Yeast)) (AA 1-64) Primary Antibody

Nop10 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 6H6 unconjugated
Catalog No. ABIN1327157
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Nop10
    Binding Specificity
    AA 1-64
    • 4
    • 2
    • 1
    Reactivity
    Human
    • 7
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Host
    Mouse
    • 7
    Clonality
    Monoclonal
    • 7
    Conjugate
    This Nop10 antibody is un-conjugated
    • 4
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 4
    • 4
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant NOP10.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

    Clone
    6H6
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Nop10
    Alternative Name
    NOP10 (Nop10 Antibody Abstract)
    Synonyms
    DKCB1, NOLA3, NOP10P, 1110036B12Rik, Nola3, nola3, zgc:109956, NOP10 ribonucleoprotein, NOP10 ribonucleoprotein homolog (yeast), NOP10, Nop10, nop10
    Background
    Full Gene Name: NOP10 ribonucleoprotein homolog (yeast)
    Synonyms: MGC70651,NOLA3,NOP10P
    Gene ID
    55505
    NCBI Accession
    NP_061118, NM_018648
You are here:
help Support