Nop10 antibody (NOP10 Ribonucleoprotein Homolog (Yeast)) (AA 1-64)

Details for Product anti-Nop10 Antibody No. ABIN1327157
Antigen
Epitope
AA 1-64
4
2
1
Reactivity
Human
7
2
2
2
2
2
1
1
1
1
1
1
1
Host
Mouse
7
Clonality (Clone)
Monoclonal ()
Conjugate
This Nop10 antibody is un-conjugated
1
1
1
Application
ELISA, Western Blotting (WB)
4
4
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant NOP10.
Immunogen

immunogen: NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

Clone 6H6
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name NOP10 (Nop10 Antibody Abstract)
Background Full Gene Name: NOP10 ribonucleoprotein homolog (yeast)
Synonyms: MGC70651,NOLA3,NOP10P
Gene ID 55505
NCBI Accession NP_061118, NM_018648
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-NOP10 Ribonucleoprotein Homolog (Yeast) (Nop10) (AA 1-64) antibody (ABIN1327157) Western Blot detection against Immunogen (32.78 KDa) .
Image no. 2 for anti-NOP10 Ribonucleoprotein Homolog (Yeast) (Nop10) (AA 1-64) antibody (ABIN1327157) Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.