SLC22A16 antibody (Solute Carrier Family 22 (Organic Cation Transporter), Member 16)

Details for Product anti-SLC22A16 Antibody No. ABIN2361661
Antigen
Reactivity
Human
13
Host
Rabbit
8
5
Clonality
Polyclonal
Conjugate
This SLC22A16 antibody is un-conjugated
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
9
4
4
2
Options
Immunogen Synthetic peptide corresponding to CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Sequence CSRNKRENTS SLGYEYTGSK KEFPCVDGYI YDQNTWKSTA VTQWNLVCDR
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics SLC22A16 (Solute Carrier Family 22 Member 16, Carnitine Transporter 2, CT2, Fly-like Putative Transporter 2, FLIPT2, Flipt 2, Organic Cation Transporter OKB1, Organic Cation/Carnitine Transporter 6, OCT6)
Purification Purified by Protein A affinity chromatography.
Antigen
Alternative Name SLC22A16 (SLC22A16 Antibody Abstract)
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Reconstitute with 100 μL dH2O to 1 mg/mL.
Buffer Supplied as a lyophilized powder in PBS.
Storage -20 °C
Storage Comment -20°C