SLC22A16 antibody (Solute Carrier Family 22 (Organic Cation Transporter), Member 16)

Details for Product anti-SLC22A16 Antibody No. ABIN630397
Antigen
Reactivity
Human
13
Host
Rabbit
8
5
Clonality
Polyclonal
Conjugate
This SLC22A16 antibody is un-conjugated
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
9
4
4
2
Options
Immunogen SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Purification Purified
Antigen
Alternative Name SLC22A16 (SLC22A16 Antibody Abstract)
Background Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).
Molecular Weight 63 kDa (MW of target protein)
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC22A16 Blocking Peptide, catalog no. 33R-1816, is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16) antibody (ABIN630397) SLC22A16 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16) antibody (ABIN630397) SLC22A16 antibody used at 2.5 ug/ml to detect target protein.