SLC22A16 antibody
-
- Target See all SLC22A16 Antibodies
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A16 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
- Top Product
- Discover our top product SLC22A16 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A16 Blocking Peptide, catalog no. 33R-1816, is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Alternative Name
- SLC22A16 (SLC22A16 Products)
- Synonyms
- CT2 antibody, FLIPT2 antibody, OAT6 antibody, OCT6 antibody, OKB1 antibody, dJ261K5.1 antibody, slc22a16 antibody, 4921504E14Rik antibody, solute carrier family 22 member 16 antibody, solute carrier family 22 member 16 L homeolog antibody, solute carrier family 22 (organic cation transporter), member 16 antibody, SLC22A16 antibody, slc22a16.L antibody, Slc22a16 antibody
- Background
- Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).
- Molecular Weight
- 63 kDa (MW of target protein)
-