SLC41A2 antibody (Solute Carrier Family 41, Member 2) (N-Term)

Details for Product anti-SLC41A2 Antibody No. ABIN2362102
Antigen
  • MGC83802
  • slc41a1-l1
  • SLC41A1-L1
  • A230035L05Rik
  • solute carrier family 41 member 2
  • solute carrier family 41 member 2 L homeolog
  • solute carrier family 41, member 2
  • Slc41a2
  • slc41a2.L
  • SLC41A2
  • slc41a2
Epitope
N-Term
10
9
7
4
1
Reactivity
Human
54
5
2
2
2
2
2
Host
Rabbit
54
Clonality
Polyclonal
Conjugate
This SLC41A2 antibody is un-conjugated
7
5
5
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
35
33
29
3
2
1
Options
Immunogen N-terminus of SLC41A2 corresponding to SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
Sequence SCSQKYDDYA NYNYCDGRET SETTAMLQDE DISSDGDEDA IVEVTPKLPK
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics SLC41A2 (Solute Carrier Family 41 Member 2, DKFZp434K0427, DKFZP434K0427, MGC125330, MGC125331, SLC41A1-L1)
Purification Purified by Protein A affinity chromatography.
Plasmids, Primers & others Plasmids, Primers & others SLC41A2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name SLC41A2 (SLC41A2 Antibody Abstract)
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Reconstitute with 100 μL dH2O to 1 mg/mL.
Buffer Supplied as a lyophilized powder in PBS.
Storage -20 °C
Storage Comment -20°C
Did you look for something else?