WNT7A antibody (C-Term)
-
- Target See all WNT7A Antibodies
- WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))
-
Binding Specificity
- AA 226-256, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT7A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- YVLKDKYNEA VHVEPVRASR NKRPTFLKIK K
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: wingless-type MMTV integration site family, member 7A
Protein Name: Protein Wnt-7a - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product WNT7A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))
- Alternative Name
- WNT7A (WNT7A Products)
- Background
-
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.
Synonyms: Protein Wnt-7a antibody|Protein Wnt-7a precursor antibody|Proto oncogene Wnt7a protein antibody|proto-oncogene wnt7a protein antibody| wingless-type MMTV integration site family, member 7A antibody|WNT7A antibody|WNT7A_HUMAN antibody - Gene ID
- 7476
- UniProt
- O00755
- Pathways
- WNT Signaling, Stem Cell Maintenance, Asymmetric Protein Localization
-