CYP27B1 antibody (C-Term)
-
- Target See all CYP27B1 Antibodies
- CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))
-
Binding Specificity
- AA 475-508, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP27B1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- HFEVQPEPGA APVRPKTRTV LVPERSINLQ FLDR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cytochrome P450, family 27, subfamily B, polypeptide 1
Protein Name: 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CYP27B1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))
- Alternative Name
- CYP27B1 (CYP27B1 Products)
- Background
-
CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.
Synonyms: 1alpha(OH)ase antibody|25-hydroxyvitamin D(3) 1-alpha-hydroxylase antibody|25-hydroxyvitamin D-1 alpha hydroxylase antibody|25-OHD-1 alpha-hydroxylase antibody|Calcidiol 1-monooxygenase antibody|CP27B_HUMAN antibody|CP2B antibody|CYP1 antibody|CYP1ALPHA antibody|CYP27B antibody|Cyp27b1 antibody|Cytochrome p450 27B1 antibody|Cytochrome p450 27B13 antibody|Cytochrome P450 family 27 subfamily B polypeptide 1 antibody|Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1 antibody| Cytochrome P450 subfamily XXVIIB polypeptide 1 antibody|Cytochrome P450C1 alpha antibody| Cytochrome P450VD1-alpha antibody|mitochondrial antibody|P450C1 alpha antibody|P450c1 antibody|P450C1-alpha antibody|P450VD1-alpha antibody|PDDR antibody|VD3 1A hydroxylase antibody|VDD1 antibody|VDDR antibody|VDDR I antibody|VDDRI antibody|VDR antibody - Gene ID
- 1594
- UniProt
- O15528
- Pathways
- Metabolism of Steroid Hormones and Vitamin D
-