TGFBR2 antibody (N-Term)
-
- Target See all TGFBR2 Antibodies
- TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))
-
Binding Specificity
- AA 96-128, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGFBR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.
- Sequence
- TLETVCHDPK LPYHDFILED AASPKCIMKE KKK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.
Gene Name: transforming growth factor, beta receptor II (70/80 kDa)
Protein Name: TGF-beta receptor type-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TGFBR2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Mechanism Investigation of the Improvement of Chang Run Tong on the Colonic Remodeling in Streptozotocin-Induced Diabetic Rats." in: Journal of diabetes research, Vol. 2016, pp. 1826281, (2016) (PubMed).
: "Effect of Kuijie Granule on the Expression of TGF-β/Smads Signaling Pathway in Patients with Ulcerative Colitis." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2016, pp. 2601830, (2016) (PubMed).
: "
-
Mechanism Investigation of the Improvement of Chang Run Tong on the Colonic Remodeling in Streptozotocin-Induced Diabetic Rats." in: Journal of diabetes research, Vol. 2016, pp. 1826281, (2016) (PubMed).
-
- Target
- TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))
- Alternative Name
- TGFBR2 (TGFBR2 Products)
- Background
-
TGFBR2 (transforming growth factor, beta receptor II (70/80 kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
Synonyms: AAT 3 antibody|AAT3 antibody|FAA 3 antibody|FAA3 antibody|HNPCC6 antibody|LDS1B antibody|LDS2B antibody|MFS 2 antibody|MFS2 antibody| RIIC antibody|TAAD 2 antibody|TAAD2 antibody|TbetaR II antibody|TbetaR-II antibody|TGF beta receptor type 2 antibody|TGF beta receptor type II antibody|TGF beta receptor type IIB antibody|TGF beta type II receptor antibody|TGF-beta receptor type II antibody|TGF-beta receptor type-2 antibody|TGF-beta type II receptor antibody|TGFB R2 antibody|TGFbeta RII antibody|TGFBR 2 antibody|TGFBR2 antibody| TGFR 2 antibody|TGFR-2 antibody|TGFR2 antibody|TGFR2_HUMAN antibody|Transforming growth factor beta receptor II antibody|Transforming growth factor beta receptor type II antibody|Transforming growth factor beta receptor type IIC antibody|Transforming growth factor-beta receptor type II antibody - Gene ID
- 7048
- UniProt
- P37173
-