MMP10 antibody (C-Term)
-
- Target See all MMP10 Antibodies
- MMP10 (Matrix Metallopeptidase 10 (Stromelysin 2) (MMP10))
-
Binding Specificity
- AA 409-443, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Stromelysin-2(MMP10) detection. Tested with WB in Human.
- Sequence
- RFDENSQSME QGFPRLIADD FPGVEPKVDA VLQAF
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Stromelysin-2(MMP10) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 10 (stromelysin 2)
Protein Name: Stromelysin-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human MMP10 (409-443aa RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF), different from the related mouse sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product MMP10 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MMP10 (Matrix Metallopeptidase 10 (Stromelysin 2) (MMP10))
- Alternative Name
- MMP10 (MMP10 Products)
- Background
-
Stromelysin-2 also known as matrix metalloproteinase-10 (MMP-10) or transin-2 is an enzyme that in humans is encoded by the MMP10 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Synonyms: Matrix metallopeptidase 10 (stromelysin 2) antibody|Matrix metalloprotease 10 antibody| Matrix metalloproteinase 10 (stromelysin 2) antibody|Matrix metalloproteinase 10 antibody| Matrix metalloproteinase-10 antibody|MMP 10 antibody|MMP-10 antibody|Mmp10 antibody| MMP10_HUMAN antibody|SL 2 antibody|SL-2 antibody|SL2 antibody|STMY 2 antibody|STMY2 antibody|Stromelysin 2 antibody|Stromelysin II antibody|Stromelysin-2 antibody|Stromelysin2 antibody|StromelysinII antibody|Transin 2 antibody|Transin-2 antibody|Transin2 antibody - Gene ID
- 4319
- UniProt
- P09238
-