FE65 antibody (N-Term)
-
- Target See all FE65 (APBB1) Antibodies
- FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))
-
Binding Specificity
- AA 21-56, N-Term
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FE65 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Amyloid beta A4 precursor protein-binding family B member 1(APBB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- ALSLPLPLHA AHNQLLNAKL QATAVGPKDL RSAMGE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Amyloid beta A4 precursor protein-binding family B member 1(APBB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Protein Name: Amyloid beta A4 precursor protein-binding family B member 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human FE65 (21-56aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Isotype
- IgG
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))
- Alternative Name
- APBB1 (APBB1 Products)
- Background
-
APBB1 is also known as RIR or FE65. The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Synonyms: Adaptor protein FE65a2 antibody|Amyloid beta (A4) precursor protein binding family B member 1 antibody|Amyloid Beta A4 Precursor Protein Binding Family B antibody|Amyloid beta A4 precursor protein binding family B member 1 antibody|Amyloid beta A4 precursor protein-binding family B member 1 antibody|Amyloid beta precursor protein binding family B member 1 antibody|APBB 1 antibody|APBB1 antibody|APBB1_HUMAN antibody|FE 65 antibody|Fe65 protein antibody|Protein Fe65 antibody|RIR antibody|stat like protein antibody - Gene ID
- 322
- UniProt
- O00213
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-