ATP2A2 antibody (N-Term)

Catalog No. ABIN3043793

Product Details anti-ATP2A2 Antibody

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Binding Specificity: AA 1-32, N-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: MENAHTKTVE EVLGHFGVNE STGLSLEQVK KL

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-ATP2A2 antibody (ABIN3043793)

Guo, Zeng, Zhang, Zhang, Li, Wu, Guan, Liu, Zhang, Li, Wan: "Extracellular matrix of mechanically stretched cardiac fibroblasts improves viability and metabolic activity of ventricular cells." in: International journal of medical sciences, Vol. 10, Issue 13, pp. 1837-45, (2013) (PubMed).

Target Details for ATP2A2

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Alternative Name: ATP2A2 (ATP2A2 Products)

Background: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

Synonyms: AT2A2_HUMAN antibody|ATP2A2 antibody|ATP2B antibody|ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody|Calcium pump 2 antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody|Cardiac Ca2+ ATPase antibody|DAR antibody|DD antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|MGC45367 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody|SERCA 2 antibody|SERCA2 antibody|serca2a antibody|slow twitch skeletal muscle isoform antibody|SR Ca(2+)-ATPase 2 antibody

Gene ID: 488

UniProt: P16615

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process