CCT3 antibody (C-Term)

Catalog No. ABIN4886513

Product Details anti-CCT3 Antibody

Target: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Binding Specificity: AA 497-536, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT3 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.

Sequence: EPLAVKLQTY KTAVETAVLL LRIDDIVSGH KKKGDDQSRQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.
Gene Name: chaperonin containing TCP1 subunit 3
Protein Name: T-complex protein 1 subunit gamma

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CCT3

Target: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Alternative Name: CCT3 (CCT3 Products)

Background: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Synonyms: CCT 3 | CCT3 | CCT gamma | CCT-gamma | CCTG | CCT G | hTRiC5 | PIG48 | TCP 1 gamma | TCP-1-gamma | TRIC5 | P49368

Gene ID: 7203

UniProt: P49368