Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ATP-Binding Cassette, Sub-Family F (GCN20), Member 1 (ABCF1) (AA 642-739) antibody Primary Antibody

ABCF1 Reactivity: Human IF, ELISA Host: Mouse Monoclonal 1B4 unconjugated
Catalog No. ABIN513037
$364.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    ATP-Binding Cassette, Sub-Family F (GCN20), Member 1 (ABCF1)
    Binding Specificity
    AA 642-739
    • 13
    • 9
    • 8
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 63
    • 37
    • 34
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Host
    Mouse
    Clonality
    Monoclonal
    Conjugate
    Un-conjugated
    • 29
    • 5
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), ELISA
    • 45
    • 24
    • 23
    • 13
    • 8
    • 7
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant ABCF1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES

    Clone
    1B4
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    ATP-Binding Cassette, Sub-Family F (GCN20), Member 1 (ABCF1)
    Alternative Name
    ABCF1 (ABCF1 Antibody Abstract)
    Synonyms
    ABC27, ABC50, AU041969, Abc50, D17Wsu166e, GCN20, zgc:85667, wu:fb79c06, wu:fc39a05, wu:fj94a08, ABCF1, MGC81714, ATP binding cassette subfamily F member 1, ATP-binding cassette, sub-family F (GCN20), member 1, ATP binding cassette subfamily F member 1 L homeolog, ATP-binding cassette sub-family F member 1, ABCF1, Abcf1, abcf1, abcf1.L, CpipJ_CPIJ005705, TGME49_318710, PITG_06772
    Background
    Full Gene Name: ATP-binding cassette, sub-family F (GCN20), member 1
    Synonyms: ABC27,ABC50
    Gene ID
    23
    NCBI Accession
    NP_001081, NM_001090
You are here:
help Support