Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GAL4 antibody (Galectin 4) AA 51-150 Primary Antibody

LGALS4 Reactivity: Human IHC (p), ELISA, WB Host: Mouse Monoclonal 1E8 unconjugated
Catalog No. ABIN517491
$611.43
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all GAL4 (LGALS4) Antibodies
    GAL4 (LGALS4)
    Binding Specificity
    • 10
    • 10
    • 9
    • 8
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 51-150
    Reactivity
    • 55
    • 10
    • 8
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 60
    • 7
    Mouse
    Clonality
    • 61
    • 6
    Monoclonal
    Conjugate
    • 35
    • 8
    • 6
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This GAL4 antibody is un-conjugated
    Application
    • 50
    • 32
    • 25
    • 24
    • 10
    • 8
    • 5
    • 5
    • 4
    • 2
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant LGALS4.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: LGALS4 (NP_006140, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI

    Clone
    1E8
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    GAL4 (LGALS4)
    Alternative Name
    LGALS4 (LGALS4 Products)
    Synonyms
    LGALS4, gal4, l36lbp, MGC86186, galectin-4, xgalectin-VIa, gal-4, L36LBP, L-36, L36LBI, GAL4, galectin 4, lectin, galactoside-binding, soluble, 4 L homeolog, Galectin-4, lectin, galactose binding, soluble 4, LGALS4, lgals4.L, leg4, Lgals4
    Background
    Full Gene Name: lectin, galactoside-binding, soluble, 4
    Synonyms: GAL4,L36LBP
    Gene ID
    NCBI Accession
    NP_006140, NM_006149
You are here:
help Support