GAL4 antibody (Galectin 4) AA 51-150

Catalog No. ABIN517491

Product Details anti-GAL4 Antibody

Target: GAL4 (LGALS4)

Binding Specificity: AA 51-150

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This GAL4 antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)

Purpose: Mouse monoclonal antibody raised against a partial recombinant LGALS4.

Cross-Reactivity: Human

Immunogen:

immunogen: LGALS4 (NP_006140, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI

Clone: 1E8

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for GAL4

Target: GAL4 (LGALS4)

Alternative Name: LGALS4 (LGALS4 Products)

Synonyms: LGALS4, gal4, l36lbp, MGC86186, galectin-4, xgalectin-VIa, gal-4, L36LBP, L-36, L36LBI, GAL4, galectin 4, lectin, galactoside-binding, soluble, 4 L homeolog, Galectin-4, lectin, galactose binding, soluble 4, LGALS4, lgals4.L, leg4, Lgals4

Background: Full Gene Name: lectin, galactoside-binding, soluble, 4
Synonyms: GAL4,L36LBP

Gene ID:

NCBI Accession: NP_006140, NM_006149