NDUFB1 antibody (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 1, 7kDa) (AA 1-105) Primary Antibody
NDUFB1
Reactivity: Human
WB
Host: Rabbit
Polyclonal
camera_alt 1
Catalog No. ABIN518235
$350.67
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-105
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This NDUFB1 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against a full-length human NDUFB1 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: NDUFB1 (NP_004536.2, 1 a.a. ~ 105 a.a) full-length human protein.
Immunogen Sequence: MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- NDUFB1 (NDUFB1 Antibody Abstract)
- Synonyms
- CI-MNLL, CI-SGDH, MNLL, NADH:ubiquinone oxidoreductase subunit B1, NDUFB1
- Background
- Full Gene Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7 kDa
Synonyms: CI-SGDH,MNLL - Gene ID
- 4707
- NCBI Accession
- NP_004536, NM_004545
You are here: