Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TNNT1 antibody (Slow Skeletal Troponin T) AA 1-251 Primary Antibody

TNNT1 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Pubmed (1 reference)
Catalog No. ABIN521026
$611.43
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all TNNT1 Antibodies
    TNNT1
    Binding Specificity
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-251
    Reactivity
    • 24
    • 13
    • 13
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 24
    • 4
    • 1
    Mouse
    Clonality
    • 26
    • 3
    Polyclonal
    Conjugate
    • 17
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This TNNT1 antibody is un-conjugated
    Application
    • 24
    • 11
    • 6
    • 5
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human TNNT1 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: TNNT1 (NP_003274, 1 a.a. ~ 251 a.a) full-length human protein.

    Immunogen Sequence: MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Li, Takai, Yuge, Furukawa, Tsuno, Tsukamoto, Kong, Moriyama, Narahara: "Novel target genes responsive to the anti-growth activity of triptolide in endometrial and ovarian cancer cells." in: Cancer letters, Vol. 297, Issue 2, pp. 198-206, (2010) (PubMed).

  • Target
    TNNT1
    Alternative Name
    TNNT1 (TNNT1 Products)
    Synonyms
    ANM, NEM5, STNT, TNT, TNTS, TNNI1, AW146156, Tnt, sTnT, ssTnT, Fang2, tnTs, Tnnt, zgc:193831, zgc:193865, troponin T1, slow skeletal type, troponin I1, slow skeletal type, troponin T1, skeletal, slow, troponin T1, slow skeletal type S homeolog, troponin T type 1 (skeletal, slow), TNNT1, TNNI1, Tnnt1, tnnt1.S, tnnt1
    Background
    Full Gene Name: troponin T type 1 (skeletal, slow)
    Synonyms: ANM,FLJ98147,MGC104241,STNT,TNT,TNTS
    Gene ID
    NCBI Accession
    NP_003274, NM_003283
You are here:
help Support