Granulysin (GNLY) (AA 46-145) antibody

Details for Product No. ABIN524008
Antigen
  • 519
  • D2S69E
  • LAG-2
  • LAG2
  • NKG5
  • TLA519
  • granulysin
  • GNLY
Epitope
AA 46-145
11
9
8
2
1
1
Reactivity
Human
49
3
Host
Mouse
35
9
4
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
6
4
2
2
2
2
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
37
25
5
3
3
2
2
2
2
1
1
1
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant GNLY.
Immunogen

immunogen: GNLY (NP_006424.2, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: LAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

Clone 2A6
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name GNLY (GNLY Antibody Abstract)
Background Full Gene Name: granulysin
Synonyms: 519,D2S69E,LAG-2,LAG2,NKG5,TLA519
Gene ID 10578
NCBI Accession NP_006424, NM_006433
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Granulysin (GNLY) (AA 46-145) antibody (ABIN524008) Detection limit for recombinant GST tagged GNLY is 0.3 ng/ml as a capture antibody.
Did you look for something else?