RPP40 antibody (Ribonuclease P/MRP 40kDa Subunit) (AA 295-363)

Catalog No. ABIN524222

Product Details anti-RPP40 Antibody

Target: RPP40

Binding Specificity: AA 295-363

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Application: ELISA, Western Blotting (WB)

Purpose: Mouse monoclonal antibody raised against a partial recombinant RPP40.

Cross-Reactivity: Human

Immunogen:

immunogen: RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Clone: 1G8

Isotype: IgG2b kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for RPP40

Target: RPP40

Alternative Name: RPP40 (RPP40 Antibody Abstract)

Synonyms: D8Bwg1265e, Rnasep1, RNASEP1, bA428J1.3, ribonuclease P 40 subunit, ribonuclease P/MRP subunit p40, Rpp40, RPP40

Background: Full Gene Name: ribonuclease P/MRP 40 kDa subunit
Synonyms: RNASEP1,bA428J1.3

Gene ID: 10799

NCBI Accession: NP_006629, NM_006638