Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPP40 antibody (Ribonuclease P/MRP 40kDa Subunit) (AA 295-363) Primary Antibody

RPP40 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1G8 unconjugated
Catalog No. ABIN524222
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    RPP40
    Binding Specificity
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 295-363
    Reactivity
    • 11
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 8
    • 4
    Mouse
    Clonality
    • 11
    • 1
    Monoclonal
    Application
    • 12
    • 5
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant RPP40.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

    Clone
    1G8
    Isotype
    IgG2b kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    RPP40
    Alternative Name
    RPP40 (RPP40 Antibody Abstract)
    Synonyms
    D8Bwg1265e, Rnasep1, RNASEP1, bA428J1.3, ribonuclease P 40 subunit, ribonuclease P/MRP subunit p40, Rpp40, RPP40
    Background
    Full Gene Name: ribonuclease P/MRP 40 kDa subunit
    Synonyms: RNASEP1,bA428J1.3
    Gene ID
    10799
    NCBI Accession
    NP_006629, NM_006638
You are here:
help Support