Sulfotransferase Family 4A, Member 1 (SULT4A1) (AA 1-100) antibody

Catalog No. ABIN525453

Product Details

Target:

Sulfotransferase Family 4A, Member 1 (SULT4A1)

Binding Specificity: AA 1-100

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: Un-conjugated

Application: ELISA, Western Blotting (WB)

Purpose: Mouse monoclonal antibody raised against a partial recombinant SULT4A1.

Cross-Reactivity: Human

Immunogen:

immunogen: SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK

Clone: 3C1

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details

Target:

Sulfotransferase Family 4A, Member 1 (SULT4A1)

Alternative Name: SULT4A1 (SULT4A1 Antibody Abstract)

Background: Full Gene Name: sulfotransferase family 4A, member 1
Synonyms: BR-STL-1,BRSTL1,DJ388M5.3,MGC40032,NST,SULTX3,hBR-STL-1

Gene ID: 25830

NCBI Accession: NP_055166, NM_014351