Sulfotransferase Family 4A, Member 1 (SULT4A1) (AA 1-100) antibody Primary Antibody
SULT4A1
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
3C1
camera_alt 3
Catalog No. ABIN525453
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-100
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- Un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant SULT4A1.
- Cross-Reactivity
- Human
- Immunogen
immunogen: SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK
- Clone
- 3C1
- Isotype
- IgG2a kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- SULT4A1 (SULT4A1 Antibody Abstract)
- Background
- Full Gene Name: sulfotransferase family 4A, member 1
Synonyms: BR-STL-1,BRSTL1,DJ388M5.3,MGC40032,NST,SULTX3,hBR-STL-1 - Gene ID
- 25830
- NCBI Accession
- NP_055166, NM_014351
You are here: