LMO3 antibody (LIM Domain Only 3 (Rhombotin-Like 2)) AA 91-146 Primary Antibody
-
- Target See all LMO3 Antibodies
- LMO3
-
Binding Specificity
- AA 91-146
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This LMO3 antibody is un-conjugated
-
Application
- Immunofluorescence (IF), ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant LMO3.
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
- Clone
- 4A8
- Isotype
- IgG2b kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- LMO3
- Alternative Name
- LMO3 (LMO3 Products)
- Synonyms
- RBTN3, RBTNL2, RHOM3, Rhom-3, AI854781, BB106490, Rbtn-3, Rbtn3, Dat1, Lmo3, zgc:110149, LMO3, DKFZp459E083, DKFZp459K207, DKFZp459L014, LIM domain only 3, LIM domain only 1, LMO3, Lmo3, Lmo1, lmo3
- Background
-
Full Gene Name: LIM domain only 3 (rhombotin-like 2)
Synonyms: DAT1,MGC26081,RBTN3,RBTNL2,RHOM3,Rhom-3 - Gene ID
- NCBI Accession
- NP_061110, NM_018640
- Pathways
- Dopaminergic Neurogenesis