Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

LMO3 antibody (LIM Domain Only 3 (Rhombotin-Like 2)) AA 91-146 Primary Antibody

LMO3 Reactivity: Human IF, ELISA, WB Host: Mouse Monoclonal 4A8 unconjugated
Catalog No. ABIN527767
$611.43
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all LMO3 Antibodies
    LMO3
    Binding Specificity
    • 4
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    AA 91-146
    Reactivity
    • 23
    • 12
    • 12
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 17
    • 5
    • 1
    Mouse
    Clonality
    • 18
    • 5
    Monoclonal
    Conjugate
    • 13
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This LMO3 antibody is un-conjugated
    Application
    • 14
    • 13
    • 5
    • 5
    • 2
    • 1
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant LMO3.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR

    Clone
    4A8
    Isotype
    IgG2b kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    LMO3
    Alternative Name
    LMO3 (LMO3 Products)
    Synonyms
    RBTN3, RBTNL2, RHOM3, Rhom-3, AI854781, BB106490, Rbtn-3, Rbtn3, Dat1, Lmo3, zgc:110149, LMO3, DKFZp459E083, DKFZp459K207, DKFZp459L014, LIM domain only 3, LIM domain only 1, LMO3, Lmo3, Lmo1, lmo3
    Background
    Full Gene Name: LIM domain only 3 (rhombotin-like 2)
    Synonyms: DAT1,MGC26081,RBTN3,RBTNL2,RHOM3,Rhom-3
    Gene ID
    NCBI Accession
    NP_061110, NM_018640
    Pathways
    Dopaminergic Neurogenesis
You are here:
help Support