DLK2 antibody (delta-Like 2 Homolog (Drosophila)) (AA 1-383)

Details for Product anti-DLK2 Antibody No. ABIN528812
Antigen
Epitope
AA 1-383
11
9
4
2
1
Reactivity
Human
33
9
4
1
1
1
1
1
1
Host
Mouse
35
2
Clonality
Polyclonal
Conjugate
This DLK2 antibody is un-conjugated
4
3
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
29
23
6
5
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human DLK2 protein.
Brand MaxPab®
Immunogen

immunogen: DLK2 (NP_076421.2, 1 a.a. ~ 383 a.a) full-length human protein.

Immunogen Sequence: MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL

Cross-Reactivity Human
Antigen
Alternative Name DLK2 (DLK2 Antibody Abstract)
Background Full Gene Name: delta-like 2 homolog (Drosophila)
Synonyms: EGFL9,MGC111055,MGC2487
Gene ID 65989
NCBI Accession NP_076421, NM_023932
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-delta-Like 2 Homolog (Drosophila) (DLK2) (AA 1-383) antibody (ABIN528812) Western Blot analysis of DLK2 expression in transfected 293T cell line by DLK2 MaxPab...
Product cited in: Nueda, Naranjo, Baladrón, Laborda: "The proteins DLK1 and DLK2 modulate NOTCH1-dependent proliferation and oncogenic potential of human SK-MEL-2 melanoma cells." in: Biochimica et biophysica acta, Vol. 1843, Issue 11, pp. 2674-84, 2014 (PubMed).