ESCO1 antibody (Establishment of Cohesion 1 Homolog 1 (S. Cerevisiae)) (AA 1-172)

Catalog No. ABIN530281

Product Details anti-ESCO1 Antibody

Target: ESCO1

See all ESCO1 Antibodies

Binding Specificity: AA 1-172

Reactivity: Human

Host: Mouse

Clonality: Polyclonal

Conjugate: This ESCO1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Mouse polyclonal antibody raised against a full-length human ESCO1 protein.

Brand: MaxPab®

Cross-Reactivity: Human

Immunogen:

immunogen: ESCO1 (AAH36943.1, 1 a.a. ~ 172 a.a) full-length human protein.

Immunogen Sequence: MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for ESCO1

Target: ESCO1

See all ESCO1 Antibodies

Alternative Name: ESCO1 (ESCO1 Antibody Abstract)

Synonyms: A930014I12Rik, CTF, ECO1, EFO1, ESO1, establishment of sister chromatid cohesion N-acetyltransferase 1, Esco1, ESCO1

Background: Full Gene Name: establishment of cohesion 1 homolog 1 (S. cerevisiae)
Synonyms: A930014I12Rik,CTF,ECO1,EFO1,ESO1,KIAA1911,MGC105022

Gene ID: 114799