ESCO1 antibody (Establishment of Cohesion 1 Homolog 1 (S. Cerevisiae)) (AA 1-172)

Details for Product anti-ESCO1 Antibody No. ABIN530281
Target
Binding Specificity
AA 1-172
3
2
2
1
1
1
Reactivity
Human
17
5
3
2
2
1
1
Host
Mouse
16
1
Clonality
Polyclonal
Conjugate
This ESCO1 antibody is un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
11
3
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human ESCO1 protein.
Brand MaxPab®
Immunogen

immunogen: ESCO1 (AAH36943.1, 1 a.a. ~ 172 a.a) full-length human protein.

Immunogen Sequence: MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST

Cross-Reactivity Human
Target
Alternative Name ESCO1 (ESCO1 Antibody Abstract)
Background Full Gene Name: establishment of cohesion 1 homolog 1 (S. cerevisiae)
Synonyms: A930014I12Rik,CTF,ECO1,EFO1,ESO1,KIAA1911,MGC105022
Gene ID 114799
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Establishment of Cohesion 1 Homolog 1 (S. Cerevisiae) (ESCO1) (AA 1-172) antibody (ABIN530281) Western Blot analysis of ESCO1 expression in transfected 293T cell line by ESCO1 MaxP...