AKR1B10 antibody (C-Term)
-
- Target See all AKR1B10 Antibodies
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
-
Binding Specificity
- AA 285-316, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKR1B10 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.
- Sequence
- EMATILSFNR NWRACNVLQS SHLEDYPFNA EY
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.
Gene Name: aldo-keto reductase family 1 member B10
Protein Name: Aldo-keto reductase family 1 member B10 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
- Isotype
- IgG
- Top Product
- Discover our top product AKR1B10 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
- Alternative Name
- AKR1B10 (AKR1B10 Products)
- Background
-
Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Synonyms: AKR1B10 | AKR1B11 | AKR1B12 | ALDRLn | ARL1 | ARL-1 | ARL 1 | ARP | HIS | HSI | O60218 - Gene ID
- 57016
- UniProt
- O60218
-