Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Synaptotagmin IV (SYT4) (AA 1-99) antibody Primary Antibody

SYT4 Reactivity: Human IF, ELISA, WB Host: Mouse Monoclonal 5F8 unconjugated
Catalog No. ABIN563076
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Synaptotagmin IV (SYT4)
    Binding Specificity
    AA 1-99
    • 14
    • 9
    • 7
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 43
    • 3
    • 1
    Host
    Mouse
    Clonality
    Monoclonal
    Conjugate
    Un-conjugated
    • 21
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    • 30
    • 29
    • 9
    • 5
    • 3
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant SYT4.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR

    Clone
    5F8
    Isotype
    IgG3 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Synaptotagmin IV (SYT4)
    Alternative Name
    SYT4 (SYT4 Antibody Abstract)
    Synonyms
    CG10047, D.Syt IV, Dmel\\CG10047, SYT4, SytIV, dsyt4, syt 4, syt4, sytIV, zgc:73240, wu:fj05d11, MGC172491, DKFZp459O022, HsT1192, Synaptotagmin 4, synaptotagmin IV, synaptotagmin 4, Syt4, syt4, SYT4, LOC657001
    Background
    Full Gene Name: synaptotagmin IV
    Synonyms: HsT1192,KIAA1342
    Gene ID
    6860
    NCBI Accession
    NP_065834, NM_020783
    Pathways
    Synaptic Membrane, Synaptic Vesicle Exocytosis
You are here:
help Support