Synaptotagmin IV (SYT4) (AA 1-99) antibody Primary Antibody
-
- Target
- Synaptotagmin IV (SYT4)
- Binding Specificity
-
AA 1-99
- Reactivity
-
Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
-
Un-conjugated
- Application
-
Immunofluorescence (IF), ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant SYT4.
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR
- Clone
- 5F8
- Isotype
- IgG3 kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Synaptotagmin IV (SYT4)
- Alternative Name
- SYT4 (SYT4 Antibody Abstract)
- Synonyms
- CG10047, D.Syt IV, Dmel\\CG10047, SYT4, SytIV, dsyt4, syt 4, syt4, sytIV, zgc:73240, wu:fj05d11, MGC172491, DKFZp459O022, HsT1192, Synaptotagmin 4, synaptotagmin IV, synaptotagmin 4, Syt4, syt4, SYT4, LOC657001
- Background
-
Full Gene Name: synaptotagmin IV
Synonyms: HsT1192,KIAA1342 - Gene ID
- 6860
- NCBI Accession
- NP_065834, NM_020783
- Pathways
- Synaptic Membrane, Synaptic Vesicle Exocytosis