Synaptotagmin IV (SYT4) (AA 1-99) antibody

Catalog No. ABIN563076

Product Details

Target: Synaptotagmin IV (SYT4)

See all Synaptotagmin IV (SYT4) Antibodies

Binding Specificity: AA 1-99

See all available epitopes across SYT4 antibodies

• AA 57-85 14
• N-Term 9
• AA 73-97 7
• AA 1-99 2
• AA 38-190 2
• AA 1-100 1
• AA 1-30 1
• Middle Region 1
• full length 1

Reactivity: Human

See all available reactivities across SYT4 antibodies

• Human 43
• Mouse 3
• Rat 1

Host: Mouse

Clonality: Monoclonal

Conjugate: Un-conjugated

See all available conjugates across SYT4 antibodies

• Un-conjugated 21
• Biotin 3
• APC 2
• Alkaline Phosphatase (AP) 2
• FITC 2
• HRP 2
• PE 2
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 594 1
• Alexa Fluor 647 1
• Alexa Fluor 680 1
• Alexa Fluor 750 1
• CF 1
• Carboxyfluorescein (CFS) 1
• Cy3 1
• Cy5 1

Application: Immunofluorescence (IF), ELISA, Western Blotting (WB)

See all available applications across SYT4 antibodies

• Western Blotting (WB) 30
• ELISA 29
• Immunohistochemistry (IHC) 9
• Immunofluorescence (IF) 5
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3
• Flow Cytometry (FACS) 1

Purpose: Mouse monoclonal antibody raised against a partial recombinant SYT4.

Cross-Reactivity: Human

Immunogen:

immunogen: SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR

Clone: 5F8

Isotype: IgG3 kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details

Target: Synaptotagmin IV (SYT4)

Alternative Name: SYT4 (SYT4 Antibody Abstract)

Synonyms: CG10047, D.Syt IV, Dmel\\CG10047, SYT4, SytIV, dsyt4, syt 4, syt4, sytIV, zgc:73240, wu:fj05d11, MGC172491, DKFZp459O022, HsT1192, Synaptotagmin 4, synaptotagmin IV, synaptotagmin 4, Syt4, syt4, SYT4, LOC657001

Background: Full Gene Name: synaptotagmin IV
Synonyms: HsT1192,KIAA1342

Gene ID: 6860

NCBI Accession: NP_065834, NM_020783

Pathways: Synaptic Membrane, Synaptic Vesicle Exocytosis