Protein tyrosine Phosphatase, Receptor Type, F Polypeptide (PTPRF), Interacting Protein (Liprin), alpha 3 (PPFIA3) (AA 1043-1139) antibody

Details for Product No. ABIN563679
Antigen
Epitope
AA 1043-1139
5
1
1
1
1
Reactivity
Human
16
11
10
2
2
2
1
1
Host
Mouse
17
Clonality
Polyclonal
Application
ELISA, Western Blotting (WB)
17
9
2
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PPFIA3.
Immunogen

immunogen: PPFIA3 (NP_003651, 1043 a.a. ~ 1139 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL

Cross-Reactivity Human
Antigen
Alternative Name PPFIA3 (PPFIA3 Antibody Abstract)
Background Full Gene Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Synonyms: KIAA0654,LPNA3,MGC126567,MGC126569
Gene ID 8541
NCBI Accession NP_003651, NM_003660
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protein tyrosine Phosphatase, Receptor Type, F Polypeptide (PTPRF), Interacting Protein (Liprin), alpha 3 (PPFIA3) (AA 1043-1139) antibody (ABIN563679) PPFIA3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of PPFIA3 ex...
Image no. 2 for anti-Protein tyrosine Phosphatase, Receptor Type, F Polypeptide (PTPRF), Interacting Protein (Liprin), alpha 3 (PPFIA3) (AA 1043-1139) antibody (ABIN563679) Western Blot detection against Immunogen (36.78 KDa) .