SEC22C antibody (SEC22 Vesicle Trafficking Protein Homolog C (S. Cerevisiae)) (AA 3-68)

Details for Product anti-SEC22C Antibody No. ABIN563946
Target
Binding Specificity
AA 3-68
2
1
1
Reactivity
Human
5
3
2
2
2
2
2
1
1
Host
Mouse
5
Clonality
Polyclonal
Application
ELISA, Western Blotting (WB)
5
2
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant SEC22L3.
Immunogen

immunogen: SEC22L3 (NP_116752, 3 a.a. ~ 68 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDV

Cross-Reactivity Human
Target
Alternative Name SEC22C (SEC22C Antibody Abstract)
Background Full Gene Name: SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
Synonyms: DKFZp761F2321,MGC13261,MGC5373,SEC22L3
Gene ID 9117
NCBI Accession NP_116752, NM_032970
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-SEC22 Vesicle Trafficking Protein Homolog C (S. Cerevisiae) (SEC22C) (AA 3-68) antibody (ABIN563946) Western Blot detection against Immunogen (33.37 KDa) .