GTF2IRD1 antibody (General Transcription Factor II I Repeat Domain-Containing 1) (AA 431-530)

Details for Product anti-GTF2IRD1 Antibody No. ABIN564125
Antigen
  • Gtf3
  • 1700012P16Rik
  • BEN
  • Cream1
  • ESTM9
  • GTF3
  • Gtf2il
  • MusTRD1
  • Tg(Alb1-Myc)166.8Sst
  • WBSCR11
  • X83320
  • GTF2IRD1
  • CREAM1
  • MUSTRD1
  • RBAP2
  • WBS
  • WBSCR12
  • hMusTRD1alpha1
  • XBEN
  • XWBSCR11
  • cream1
  • gtf3
  • mustrd1
  • rbap2
  • wbs
  • wbscr11
  • wbscr12
  • GTF2I repeat domain containing 1
  • general transcription factor II I repeat domain-containing 1
  • general transcription factor II-I repeat domain-containing protein 1
  • GTF2I repeat domain containing 1 S homeolog
  • GTF2IRD1
  • Gtf2ird1
  • gtf2ird1
  • LOC100461122
  • gtf2ird1.S
Epitope
AA 431-530
18
10
8
7
7
4
3
2
2
2
1
1
1
1
1
Reactivity
Human
101
42
33
12
8
7
6
6
5
3
1
1
1
Host
Mouse
80
14
7
Clonality
Polyclonal
Conjugate
This GTF2IRD1 antibody is un-conjugated
6
4
4
3
3
3
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
75
55
26
12
11
5
5
3
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant GTF2IRD1.
Immunogen

immunogen: GTF2IRD1 (NP_005676, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSED

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others GTF2IRD1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name GTF2IRD1 (GTF2IRD1 Antibody Abstract)
Background Full Gene Name: GTF2I repeat domain containing 1
Synonyms: BEN,CREAM1,GTF3,MUSTRD1,RBAP2,WBS,WBSCR11,WBSCR12,hMusTRD1alpha1
Gene ID 9569
NCBI Accession NP_005676, NM_005685
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-General Transcription Factor II I Repeat Domain-Containing 1 (GTF2IRD1) (AA 431-530) antibody (ABIN564125) Western Blot detection against Immunogen (37.11 KDa) .
Did you look for something else?