GTF2IRD1 antibody (General Transcription Factor II I Repeat Domain-Containing 1) (AA 431-530)

Details for Product anti-GTF2IRD1 Antibody No. ABIN564125
Target
Binding Specificity
AA 431-530
14
8
7
7
5
4
2
2
1
1
1
1
1
1
1
Reactivity
Human
64
19
18
10
7
7
6
5
4
3
1
1
1
Host
Mouse
48
9
7
Clonality
Polyclonal
Conjugate
This GTF2IRD1 antibody is un-conjugated
5
4
4
3
3
3
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
45
40
16
9
7
4
3
2
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant GTF2IRD1.
Immunogen

immunogen: GTF2IRD1 (NP_005676, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSED

Cross-Reactivity Human
Target
Alternative Name GTF2IRD1 (GTF2IRD1 Antibody Abstract)
Background Full Gene Name: GTF2I repeat domain containing 1
Synonyms: BEN,CREAM1,GTF3,MUSTRD1,RBAP2,WBS,WBSCR11,WBSCR12,hMusTRD1alpha1
Gene ID 9569
NCBI Accession NP_005676, NM_005685
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-General Transcription Factor II I Repeat Domain-Containing 1 (GTF2IRD1) (AA 431-530) antibody (ABIN564125) Western Blot detection against Immunogen (37.11 KDa) .