PAN2 antibody (PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae)) (AA 1099-1198)

Details for Product anti-PAN2 Antibody No. ABIN564262
Antigen
Epitope
AA 1099-1198
10
10
8
7
4
2
Reactivity
Human
30
4
3
Host
Mouse
28
2
Clonality (Clone)
Monoclonal ()
Conjugate
This PAN2 antibody is un-conjugated
3
3
3
2
2
2
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
26
24
5
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant USP52.
Immunogen

immunogen: USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL

Clone 6A7
Isotype IgG1 kappa
Cross-Reactivity Human
Antigen
Alternative Name PAN2 (PAN2 Antibody Abstract)
Background Full Gene Name: PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
Synonyms: FLJ39360,KIAA0710,USP52,hPAN2
Gene ID 9924
NCBI Accession NP_055686, NM_014871
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae) (PAN2) (AA 1099-1198) antibody (ABIN564262) Immunofluorescence of monoclonal antibody to PAN2 on HeLa cell. [antibody concentrati...
Image no. 2 for anti-PAN2 Poly(A) Specific Ribonuclease Subunit Homolog (S. Cerevisiae) (PAN2) (AA 1099-1198) antibody (ABIN564262) Western Blot detection against Immunogen (36.74 KDa) .