BDKRB2 antibody (AA 357-391)
-
- Target See all BDKRB2 Antibodies
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Binding Specificity
- AA 357-391
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BDKRB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product BDKRB2 Primary Antibody
-
-
- Application Notes
- Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Alternative Name
- BDKRB2 (BDKRB2 Products)
- Background
- Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
- UniProt
- P30411
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-