HBV Large S Protein antibody (AA 4-51)

Catalog No. ABIN5708085

Product Details anti-HBV Large S Protein Antibody

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Binding Specificity: AA 4-51

Reactivity: Hepatitis B Virus (HBV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBV Large S Protein antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Hepatitis B Virus antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Hepatitis B Virus antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HBV Large S Protein

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Alternative Name: Hepatitis B Virus (Large S Protein) (L-HBsAG Products)

Target Type: Viral Protein

Background: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

UniProt: D2X4M3