HBV Large S Protein antibody (N-Term)

Catalog No. ABIN5518758

Product Details anti-HBV Large S Protein Antibody

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Binding Specificity: AA 4-51, N-Term

Reactivity: Hepatitis B Virus (HBV), Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBV Large S Protein antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Large S protein(S) detection. Tested with WB, IHC-P in Human,HBV.

Sequence: WSSKPRQGMG TNLSVPNPLG FFPDHQLDPA FGANSNNPDW DFNPNKDQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Large S protein(S) detection. Tested with WB, IHC-P in Human,HBV.
Gene Name: long surface protein, PreS1, L protein, LHBs, large S protein, pre-S1/pre-S2/S regions, L glycoprotein, L-HBsAG, LHBs
Protein Name: Large S protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: HBV
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-HBV Large S Protein antibody (ABIN5518758)

Xiangji, Feng, Qingbao, Weifeng, Xiaoqing, Baihe, Feng, Hongyang, Mengchao: "Knockdown of HBV surface antigen gene expression by a lentiviral microRNA-based system inhibits HBV replication and HCC growth." in: Journal of viral hepatitis, Vol. 18, Issue 9, pp. 653-60, (2011) (PubMed).

Zhang, Wang, Li, Qiao: "Expression of transforming growth factor-alpha and hepatitis B surface antigen in human hepatocellular carcinoma tissues and its significance." in: World journal of gastroenterology, Vol. 10, Issue 6, pp. 830-3, (2004) (PubMed).

Paliaga, Braga: "Passive limitation of adduction after Cüppers's 'Fadenoperation' on medial recti." in: The British journal of ophthalmology, Vol. 73, Issue 8, pp. 633-5, (1989) (PubMed).

Ramsey: "Should medicine today be taught without medical ethics?" in: Connecticut medicine, Vol. 37, Issue 8, pp. 420-1, (1973) (PubMed).

Target Details for HBV Large S Protein

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Alternative Name: S (L-HBsAG Products)

Synonyms: long surface protein; PreS1; L protein; LHBs; large S protein; pre-S1/pre-S2/S regions; L glycoprotein; L-HBsAG; LHBs antibody, S antibody

Target Type: Viral Protein

Background: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

Synonyms: HbsAg | HBV | Major surface antigen

Gene ID: 944569

UniProt: D2X4M3