WNT2B antibody (Middle Region)
-
- Target See all WNT2B Antibodies
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT2B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- WNT2 B antibody was raised against the middle region of WNT2
- Purification
- Purified
- Immunogen
- WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
- Top Product
- Discover our top product WNT2B Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
- Alternative Name
- WNT2B (WNT2B Products)
- Synonyms
- WNT13 antibody, XWNT2 antibody, wnt2b antibody, XWnt-2 antibody, Xwnt-2b antibody, wnt-2b antibody, xwnt2b antibody, WNT2B antibody, Wnt13 antibody, Wnt family member 2B antibody, wingless-type MMTV integration site family, member 2Ba antibody, Wnt family member 2B L homeolog antibody, wingless-type MMTV integration site family, member 2B antibody, wingless-type MMTV integration site family, member 2Bb antibody, WNT2B antibody, Wnt2b antibody, wnt2ba antibody, wnt2b.L antibody, wnt2bb antibody
- Background
- WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- WNT Signaling
-