WNT5B antibody (C-Term)
-
- Target See all WNT5B Antibodies
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT5B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT5 B antibody was raised against the C terminal of WNT5
- Purification
- Purified
- Immunogen
- WNT5 B antibody was raised using the C terminal of WNT5 corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
- Top Product
- Discover our top product WNT5B Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT5B Blocking Peptide, catalog no. 33R-3537, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
- Alternative Name
- WNT5B (WNT5B Products)
- Synonyms
- wnt-5b antibody, xwnt5b antibody, WNT5B antibody, AW545702 antibody, Wnt-5b antibody, xwnt-5c antibody, CHUNP6928 antibody, id:ibd5111 antibody, ppt antibody, wnt-5 antibody, wnt5 antibody, wnt[b] antibody, wu:fk85g06 antibody, Wnt family member 5B antibody, wingless-type MMTV integration site family, member 5B antibody, Wnt family member 5B S homeolog antibody, wingless-type MMTV integration site family, member 5b antibody, wnt5b antibody, WNT5B antibody, Wnt5b antibody, wnt5b.S antibody
- Background
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- WNT Signaling, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation
-