Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

WNT5B antibody (C-Term)

WNT5B Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN630136
$742.70
Plus shipping costs $45.00
100 μg
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all WNT5B Antibodies
    WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
    Binding Specificity
    • 13
    • 10
    • 9
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    C-Term
    Reactivity
    • 49
    • 25
    • 12
    • 5
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 47
    • 4
    Rabbit
    Clonality
    • 48
    • 3
    Polyclonal
    Conjugate
    • 32
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This WNT5B antibody is un-conjugated
    Application
    • 34
    • 21
    • 11
    • 5
    • 5
    • 4
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Specificity
    WNT5 B antibody was raised against the C terminal of WNT5
    Purification
    Purified
    Immunogen
    WNT5 B antibody was raised using the C terminal of WNT5 corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
  • Application Notes
    WB: 1.25 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    WNT5B Blocking Peptide, catalog no. 33R-3537, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
    Alternative Name
    WNT5B (WNT5B Products)
    Synonyms
    wnt-5b antibody, xwnt5b antibody, WNT5B antibody, AW545702 antibody, Wnt-5b antibody, xwnt-5c antibody, CHUNP6928 antibody, id:ibd5111 antibody, ppt antibody, wnt-5 antibody, wnt5 antibody, wnt[b] antibody, wu:fk85g06 antibody, Wnt family member 5B antibody, wingless-type MMTV integration site family, member 5B antibody, Wnt family member 5B S homeolog antibody, wingless-type MMTV integration site family, member 5b antibody, wnt5b antibody, WNT5B antibody, Wnt5b antibody, wnt5b.S antibody
    Background
    The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.
    Molecular Weight
    39 kDa (MW of target protein)
    Pathways
    WNT Signaling, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation
You are here:
Support