VAMP5 antibody

Catalog No. ABIN630333

Product Details anti-VAMP5 Antibody

Target: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VAMP5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VAMP5

Target: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Alternative Name: VAMP5 (VAMP5 Products)

Synonyms: AF119384 antibody, Camp antibody, vesicle associated membrane protein 5 antibody, vesicle-associated membrane protein 5 antibody, VAMP5 antibody, vamp5 antibody, Vamp5 antibody

Background: Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.

Molecular Weight: 13 kDa (MW of target protein)