VAMP5 antibody (Vesicle-Associated Membrane Protein 5 (Myobrevin))

Details for Product anti-VAMP5 Antibody No. ABIN630333
Target
Reactivity
Human
21
7
4
Host
Rabbit
20
3
1
1
Clonality
Polyclonal
Conjugate
This VAMP5 antibody is un-conjugated
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
14
12
11
2
2
1
1
Options
Immunogen VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Purification Purified
Target
Alternative Name VAMP5 (VAMP5 Antibody Abstract)
Background Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
Molecular Weight 13 kDa (MW of target protein)
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5) antibody (ABIN630333) VAMP5 antibody used at 5 ug/ml to detect target protein.