VAMP5 antibody
-
- Target See all VAMP5 Antibodies
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VAMP5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
- Top Product
- Discover our top product VAMP5 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
- Alternative Name
- VAMP5 (VAMP5 Products)
- Background
- Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
- Molecular Weight
- 13 kDa (MW of target protein)
-