SLC22A7 antibody

Catalog No. ABIN630485

Product Details anti-SLC22A7 Antibody

Target: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A7 Blocking Peptide, catalog no. 33R-5265, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A7

Target: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Alternative Name: SLC22A7 (SLC22A7 Products)

Background: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.

Molecular Weight: 60 kDa (MW of target protein)