NR2F1 antibody (C-Term)
-
- Target See all NR2F1 Antibodies
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR2F1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR2 F1 antibody was raised against the C terminal of NR2 1
- Purification
- Affinity purified
- Immunogen
- NR2 F1 antibody was raised using the C terminal of NR2 1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
- Top Product
- Discover our top product NR2F1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR2F1 Blocking Peptide, catalog no. 33R-9656, is also available for use as a blocking control in assays to test for specificity of this NR2F1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
- Alternative Name
- NR2F1 (NR2F1 Products)
- Background
- Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-