NR2F1 antibody (C-Term)

Catalog No. ABIN630515

Product Details anti-NR2F1 Antibody

Target: NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR2F1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR2 F1 antibody was raised against the C terminal of NR2 1

Purification: Affinity purified

Immunogen: NR2 F1 antibody was raised using the C terminal of NR2 1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR2F1 Blocking Peptide, catalog no. 33R-9656, is also available for use as a blocking control in assays to test for specificity of this NR2F1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR2F1

Target: NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))

Alternative Name: NR2F1 (NR2F1 Products)

Background: Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway