Monoamine Oxidase A antibody (N-Term)

Catalog No. ABIN631037

Product Details anti-Monoamine Oxidase A Antibody

Target: Monoamine Oxidase A (MAOA)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Monoamine Oxidase A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAOA antibody was raised against the N terminal of MAOA

Purification: Affinity purified

Immunogen: MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAOA Blocking Peptide, catalog no. 33R-3485, is also available for use as a blocking control in assays to test for specificity of this MAOA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Monoamine Oxidase A

Target: Monoamine Oxidase A (MAOA)

Alternative Name: MAOA (MAOA Products)

Background: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Molecular Weight: 60 kDa (MW of target protein)