NKD2 antibody

Catalog No. ABIN631060

Product Details anti-NKD2 Antibody

Target: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKD2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NKD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKD2 Blocking Peptide, catalog no. 33R-1463, is also available for use as a blocking control in assays to test for specificity of this NKD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKD2

Target: NKD2 (Naked Cuticle Homolog 2 (NKD2))

Alternative Name: NKD2 (NKD2 Products)

Synonyms: nkd2 antibody, nkd2l antibody, 2210403L10Rik antibody, AW212591 antibody, Naked2 antibody, naked cuticle homolog 2b antibody, naked cuticle 2 homolog (Drosophila) antibody, naked cuticle homolog 2 antibody, naked cuticle homolog 2a antibody, nkd2b antibody, Nkd2 antibody, NKD2 antibody, nkd2a antibody

Background: In the mouse, NkDa is a Dishevelled-binding protein that functions as a negative regulator of the Wnt-beta-catenin-Tcf signaling pathway.

Molecular Weight: 34 kDa (MW of target protein)