SNRK antibody (SNF Related Kinase) (Middle Region)

Details for Product anti-SNRK Antibody No. ABIN631138
Antigen
  • HSNFRK
  • 2010012F07Rik
  • AI448042
  • AW547029
  • E030034B15
  • R74830
  • mKIAA0096
  • SNF related kinase
  • SNRK
  • Snrk
Epitope
Middle Region
16
16
8
7
7
3
2
2
1
1
1
Reactivity
Human, Rat (Rattus)
30
21
4
2
2
2
1
1
1
1
Host
Rabbit
44
3
Clonality
Polyclonal
Conjugate
This SNRK antibody is un-conjugated
4
4
4
4
4
4
Application
Western Blotting (WB)
46
31
17
4
3
3
1
1
Options
Immunogen SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
Specificity SNRK antibody was raised against the middle region of SNRK
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others SNRK products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name SNRK (SNRK Antibody Abstract)
Background SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.
Molecular Weight 84 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-SNF Related Kinase (SNRK) (Middle Region) antibody (ABIN631138) SNRK antibody used at 1 ug/ml to detect target protein.
Did you look for something else?