BRAP antibody (Middle Region)

Catalog No. ABIN631144

This Rabbit Polyclonal antibody specifically detects BRAP in WB. It exhibits reactivity toward Human.

Quick Overview for BRAP antibody (Middle Region) (ABIN631144)

Target: BRAP (BRCA1 Associated Protein (BRAP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BRAP Antibody

Binding Specificity: Middle Region

Specificity: BRAP antibody was raised against the middle region of BRAP

Purification: Affinity purified

Immunogen: BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRAP Blocking Peptide, (ABIN936134), is also available for use as a blocking control in assays to test for specificity of this BRAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRAP

Target: BRAP (BRCA1 Associated Protein (BRAP))

Alternative Name: BRAP

Background: The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.

Molecular Weight: 67 kDa (MW of target protein)