Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1) (Middle Region) antibody

Details for Product No. ABIN631178
Antigen
Epitope
Middle Region
11
9
8
6
3
2
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
68
11
10
3
3
3
2
1
1
Host
Rabbit
56
10
2
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
55
38
15
6
3
2
1
1
1
1
Options
Immunogen SULT2 B1 antibody was raised using the middle region of SULT2 1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI
Specificity SULT2 B1 antibody was raised against the middle region of SULT2 1
Purification Affinity purified
Antigen
Alternative Name SULT2B1 (SULT2B1 Antibody Abstract)
Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.
Molecular Weight 39 kDa (MW of target protein)
Pathways Steroid Hormone Biosynthesis
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SULT2B1 Blocking Peptide, catalog no. 33R-10242, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1) (Middle Region) antibody (ABIN631178) anti-Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1) (Middle Region) antibody