MTMR12 antibody (Middle Region)
-
- Target See all MTMR12 Antibodies
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTMR12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTMR12 antibody was raised against the middle region of MTMR12
- Purification
- Affinity purified
- Immunogen
- MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD
- Top Product
- Discover our top product MTMR12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTMR12 Blocking Peptide, catalog no. 33R-8086, is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
- Alternative Name
- MTMR12 (MTMR12 Products)
- Background
- MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.
- Molecular Weight
- 86 kDa (MW of target protein)
-