PRKRIR antibody

Catalog No. ABIN631280

Product Details anti-PRKRIR Antibody

Target: PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKRIR antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKRIR Blocking Peptide, catalog no. 33R-9506, is also available for use as a blocking control in assays to test for specificity of this PRKRIR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKRIR

Target: PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))

Alternative Name: PRKRIR (PRKRIR Products)

Background: PRKRIR is upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). PRKRIR may block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.

Molecular Weight: 88 kDa (MW of target protein)