TRMT61A antibody (tRNA Methyltransferase 61 Homolog A (S. Cerevisiae)) (N-Term) Primary Antibody
TRMT61A
Reactivity: Human, Mouse, Rat
WB
Host: Rabbit
Polyclonal
camera_alt 1
Catalog No. ABIN631401
$647.32
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 9 to 11 Business Days
-
- Target
- Binding Specificity
- N-Term
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- C14 ORF172 antibody was raised against the N terminal Of C14 rf172
- Purification
- Affinity purified
- Immunogen
- C14 ORF172 antibody was raised using the N terminal Of C14 rf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI
-
-
- Application Notes
- WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
C14ORF172 Blocking Peptide, catalog no. 33R-6422, is also available for use as a blocking control in assays to test for specificity of this C14ORF172 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF172 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Alternative Name
- C14ORF172 (TRMT61A Antibody Abstract)
- Synonyms
- C14orf172, GCD14, Gcd14p, TRM61, hTRM61, Gcd14, RGD1359191, Trm61, 6720458F09Rik, AI606093, zgc:86657, tRNA methyltransferase 61A, TRMT61A, Trmt61a, trmt61a
- Background
- The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 31 kDa (MW of target protein)
You are here: