POLR2K antibody (Middle Region)
-
- Target See all POLR2K Antibodies
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLR2K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- POLR2 K antibody was raised against the middle region of POLR2
- Purification
- Affinity purified
- Immunogen
- POLR2 K antibody was raised using the middle region of POLR2 corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
- Top Product
- Discover our top product POLR2K Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLR2K Blocking Peptide, catalog no. 33R-2205, is also available for use as a blocking control in assays to test for specificity of this POLR2K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
- Alternative Name
- POLR2K (POLR2K Products)
- Background
- POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.
- Molecular Weight
- 7 kDa (MW of target protein)
- Pathways
- Regulatory RNA Pathways
-