GSTa5 antibody (Glutathione S-Transferase alpha 5) (Middle Region)

Details for Product anti-GSTa5 Antibody No. ABIN631548
Antigen
Epitope
Middle Region
4
4
1
1
1
Reactivity
Human
15
8
2
1
1
1
1
1
1
1
Host
Rabbit
12
8
2
Clonality
Polyclonal
Conjugate
This GSTa5 antibody is un-conjugated
4
1
1
1
1
1
Application
Western Blotting (WB)
22
13
4
3
2
2
1
1
Options
Immunogen GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
Specificity GSTA5 antibody was raised against the middle region of GSTA5
Purification Affinity purified
Antigen
Alternative Name GSTA5 (GSTa5 Antibody Abstract)
Background GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
Molecular Weight 26 kDa (MW of target protein)
Application Notes WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GSTA5 Blocking Peptide, catalog no. 33R-7675, is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Glutathione S-Transferase alpha 5 (GSTa5) (Middle Region) antibody (ABIN631548) GSTA5 antibody used at 0.5 ug/ml to detect target protein.